• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> c-Rel Antibody

c-Rel Antibody (R31972)

  Catalog No Formulation Size Price (USD)  
Image R31972 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat kidney and 2) human HeLa lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.
IHC testing of human breast cancer tissue with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of mouse intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of rat intestine with c-Rel antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) human ThP-1, 2) rat spleen and 3) mouse thymus lysate with c-Rel antibody. Expected/observed molecular weight ~69 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P15307
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Limitations This c-Rel antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Dog
  • Applications : WB
    Reactivity : Human
  • Applications : WB, IHC-P
    Reactivity : Human, Rat
  • Applications : WB, IF, FACS, Direct ELISA
    Reactivity : Human

Description

The proto-oncogene c-Rel is a protein that in humans is encoded by the REL gene. This gene is mapped to chromosome 2p13-p12. The c-Rel protein is a member of the NF-kB family of transcription factors and contains a Rel homology domain (RHD) at its N-terminus and two C-terminal transactivation domains. c-Rel has an important role in B-cell survival and proliferation. The REL gene is amplified or mutated in several human B-cell lymphomas, including diffuse large B-cell lymphoma and Hodgkin's lymphoma.

Application Notes

Optimal dilution of the c-Rel antibody should be determined by the researcher.

Immunogen

Amino acids DQEVSESMDFRYLPDEKDAYGNKSKKQKTTLIFQKLLQD of mouse c-Rel were used as the immunogen for the c-Rel antibody.

Storage

After reconstitution, the c-Rel antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.