- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Kininogen-1 (KNG1), also known as BDK or bradykinin, is a protein that in humans is encoded by the KNG1 gene. It is mapped to 3q27.3. The KNG1 gene uses alternative splicing to generate two different proteins high molecular - weight kininogen (HMWK) and low - molecular- weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, KNG1, a peptide causing numerous physiological effects, is released from HMWK. In contrast to HMWK, LMWK is not involved in blood coagulation. In addition to that, KNG1 is a constituent of the blood coagulation system as well as the kinin-kallikrein system.
Optimal dilution of the Bradykinin antibody should be determined by the researcher.
Amino acids ECRGNLFMDINNKIANFSQSCTLYSGDDLVEAL of mouse Bradykinin were used as the immunogen for the Bradykinin antibody.
After reconstitution, the Bradykinin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.