• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> BMP4 Antibody

BMP4 Antibody (R31950)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31950 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of mouse 1) lung, 2) liver, 3) HEPA and human 4) HepG2, 5) HeLa lysate with BMP4 antibody. Predicted molecular weight: 54 kDa (precursor), 44 kDa (cleaved dimer), 23 kDa (cleaved monomer).
Western blot testing of mouse 1) lung, 2) liver, 3) HEPA and human 4) HepG2, 5) HeLa lysate with BMP4 antibody. Predicted molecular weight: 54 kDa (precursor), 44 kDa (cleaved dimer), 23 kDa (cleaved monomer).
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P12644
Localization Cytoplasmic, membrane
Applications Western blot : 0.1-0.5ug/ml
ELISA : 0.1-0.5ug/ml (human and mouse protein tested); request BSA-free format for coating
Limitations This BMP4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Bone morphogenetic protein 4 is a protein that in humans is encoded by the BMP4 gene. It is found on chromosome 14q22-q23. The protein encoded by this gene is a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. This particular family member plays an important role in the onset of endochondral bone formation in humans, and a reduction in expression has been associated with a variety of bone diseases, including the heritable disorder Fibrodysplasia Ossificans Progressiva. Alternative splicing in the 5' untranslated region of this gene has been described and three variants are described, all encoding an identical protein.

Application Notes

Optimal dilution of the BMP4 antibody should be determined by the researcher.

Immunogen

Amino acids SPKHHSQRARKKNKNCRRHSLYVDFSDVGWND of human BMP4 were used as the immunogen for the BMP4 antibody.

Storage

After reconstitution, the BMP4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all BMP4 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.