• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Bmi1 Antibody

Bmi1 Antibody (R31554)

  Catalog No Formulation Size Price (USD)  
Image R31554 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of Bmi1 antibody and Lane 1: rat spleen; 2: human HT1080; 3: (h) HeLa. Predicted molecular weight: 37-43 kDa.
Western blot testing of Bmi1 antibody and recombinant human protein (0.5ng)
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Gene ID 648
Applications Western Blot : 0.5-1ug/ml
Limitations This Bmi1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human
    Microvalidated
  • Applications : IHC-P
    Reactivity : Human
    Microvalidated
  • Applications : WB, IF, IHC-P
    Reactivity : Human, Mouse
    Microvalidated
  • Applications : WB, IF, ELISA
    Reactivity : Human
  • Applications : IHC-P, WB
    Reactivity : Human
  • Applications : WB
    Reactivity : Human
  • Applications : WB, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Bovine, Chicken
  • Applications : FACS, WB, IHC, IF, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Cow, Dog, Pig
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Mouse, Pig
    Pred. Reactivity : Dog

Description

B lymphoma Mo MLV insertion region 1, also known as RNF51, is a protein which in humans is encoded by the BMI1 gene. The gene is highly conserved in evolution as indicated by zoo blot hybridization with Bmi1 probes corresponding to the protein-encoding domain. By fluorescence in situ hybridization, the human gene is assigned to chromosome 10p13. It has a key role in regulating the proliferative activity of normal stem and progenitor cells. Most importantly, they provided evidence that the proliferative potential of leukemic stem and progenitor cells lacking BMI1 is compromised because they eventually undergo proliferation arrest and show signs of differentiation and apoptosis, leading to transplant failure of the leukemia. Complementation studies showed that the protein completely rescues these proliferative defects. Deletion analysis showed that the RING finger and helix-turn-helix domains of BMI1 were required for life span extension and repression of the tumor suppressor p16(INK4). BMI1 selectively extended the life span of these cultures. Confocal microscopy showed that the protein transiently colocalized with centromeres during interphase in HeLa cells.

Application Notes

The stated application concentrations are suggested starting amounts. Titration of the Bmi1 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Immunogen

An amino acid sequence from the middle region of human Bmi1 (IEFFDQNRLDRKVNKDKEKSKEEVNDKRYLR) was used as the immunogen for this Bmi1 antibody.

Storage

After reconstitution, the Bmi1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.