• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Beta Tubulin Antibody

Beta Tubulin Antibody [clone 2E11.] (RQ5619)

  Catalog No Formulation Size Price (USD)  
Image RQ5619 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IF/ICC staining of FFPE human U-2 OS cells with Beta Tubulin antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human U-2 OS cells with Beta Tubulin antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HEK293, 2) monkey COS-7, 3) human PC-3 and 4) human HeLa cell lysate with Beta Tubulin antibody. Predicted molecular weight: 50-55 kDa.
Western blot testing of rat 1) brain, 2) liver, 3) PC-12 and mouse 4) brain, 5) NIH3T3 and 6) RAW264.7 cell lysate with Beta Tubulin antibody. Predicted molecular weight: 50-55 kDa.
Flow cytometry testing of human U937 cells with Beta Tubulin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Beta Tubulin antibody.
Flow cytometry testing of human HEPA1-6 cells with Beta Tubulin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Beta Tubulin antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2a
Clone Name 2E11.
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P07437
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Immunocytochemistry : 2-4ug/ml
Limitations This Beta Tubulin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC, IF, ELISA
    Reactivity : Human, Mouse
  • Applications : WB, IHC, ELISA
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC, IF, ELISA
    Reactivity : Human, Mouse, Rat
    Pred. Reactivity : Bovine, Chicken, Hamster, Pig, Rat, Xenopus
  • Applications : WB, IF, IHC, FACS
    Reactivity : Human, Mouse, Rat
    Pred. Reactivity : Bovine, Chicken, Horse, Pig, Primate, Sheep, Xenopus
  • Applications : WB
    Reactivity : Human, Mouse, Rat, Monkey, Rabbit, Chicken, Dog
  • Applications : WB
    Reactivity : Human, Mouse, Rat, Primate, Dog
  • Applications : WB
    Reactivity : Human, Mouse, Rat, Monkey, Zebrafish, Chicken
  • Applications : WB, IHC-P
    Reactivity : Human
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Chicken, Mouse, Pig, Primate, Rat, Xenopus
  • Applications : IF, WB, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Bovine, Pig, Primate, Chicken, Xenopus
  • Applications : WB, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Chicken, Drosophila, Hamster, Mouse, Pig, Rat, Xenopus
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Mouse, Primate
  • Applications : WB, ELISA
    Reactivity : Human

Description

Tubulin beta chain is a protein that in humans is encoded by the TUBB gene. This gene encodes a beta tubulin protein. This protein forms a dimer with alpha tubulin and acts as a structural component of microtubules. Mutations in this gene cause cortical dysplasia, complex, with other brain malformations 6. Alternative splicing results in multiple splice variants. There are multiple pseudogenes for this gene on chromosomes 1, 6, 7, 8, 9, and 13.

Application Notes

Optimal dilution of the Beta Tubulin antibody should be determined by the researcher.

Immunogen

Amino acids EQFTAMFRRKAFLHWYTGEGMDEMEFTEAE were used as the immunogen for the Beta Tubulin antibody.

Storage

After reconstitution, the Beta Tubulin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.