• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Bax Antibody

Bax Antibody (R32761)

  Catalog No Formulation Size Price (USD)  
Image R32761 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat thymus, 2) mouse thymus, 3) mouse Hepa1-6, 3) human HeLa, 4) human MCF7 lysate with Bax antibody at 0.5ug/ml. Predicted molecular weight: 21-24 kDa.
IHC testing of FFPE human intestinal cancer tissue with Bax antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with Bax antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse intestine tissue with Bax antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat intestine tissue with Bax antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Flow cytometry testing of human A549 cells with Bax antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Bax antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q07812
Localization Cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow Cytometry : 1-2ug/10^6 cells
Limitations This Bax antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
    Recrabbitmono
  • Applications : WB
    Reactivity : Human
    Recmousemono
  • Applications : WB
    Reactivity : Human
    Recrabbitmono
  • Applications : IHC-P, WB
    Reactivity : Human
    Recrabbitmono
  • Applications : FACS, IF, WB, IHC-P
    Reactivity : Human
    Citation  Citations(22)
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : FACS, IHC-P
    Reactivity : Human
  • Applications : FACS, IF, IHC-P, WB
    Reactivity : Human
    Citation  Citations(3)
  • Applications : IHC-P
    Reactivity : Human
  • Applications : WB, FACS, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : FACS, WB, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, IHC-P, IF
    Reactivity : Human

Description

Apoptosis regulator BAX, also known as bcl-2-like protein 4, is a protein that in humans is encoded by the BAX gene. The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein forms a heterodimer with BCL2, and functions as an apoptotic activator. Additionally, this protein is reported to interact with, and increase the opening of, the mitochondrial voltage-dependent anion channel (VDAC), which leads to the loss in membrane potential and the release of cytochrome c. The expression of this gene is regulated by the tumor suppressor P53 and has been shown to be involved in P53-mediated apoptosis. Multiple alternatively spliced transcript variants, which encode different isoforms, have been reported for this gene.

Application Notes

Optimal dilution of the Bax antibody should be determined by the researcher.

Immunogen

Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

Storage

After reconstitution, the Bax antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.