Bax Antibody / BCL2-associated X (R32761)

Description

Bax, also known as BCL2-associated X protein, is a pro-apoptotic member of the BCL2 protein family that plays a critical role in the intrinsic pathway of apoptosis. It promotes programmed cell death by permeabilizing the mitochondrial outer membrane, leading to the release of cytochrome c and subsequent activation of caspases. Bax is tightly regulated at the transcriptional and post-translational levels, and its activity is modulated through interactions with other BCL2 family proteins.

Bax exists primarily in the cytosol in healthy cells but undergoes conformational changes and translocates to the mitochondria upon apoptotic stimuli. It forms homo-oligomers that are essential for pore formation and mitochondrial membrane disruption. This makes Bax a key regulator of cellular homeostasis, development, and response to stress or damage.

Multiple isoforms of Bax have been reported, resulting from alternative splicing. These isoforms may differ in their pro-apoptotic potency, subcellular localization, and expression profiles, making it important to use a Bax antibody that recognizes the relevant forms in specific experimental contexts.

A high-performance Bax antibody is essential for studies involving apoptosis, cancer, neurodegeneration, and immune response. The Bax antibody is widely used in applications such as western blot, immunohistochemistry, immunofluorescence, and flow cytometry. A well-validated Bax antibody can reliably detect expression levels and cellular distribution of Bax across different models and conditions.

NSJ Bioreagents offers a range of Bax antibody products designed for sensitivity, specificity, and versatility across research applications. Each Bax antibody is quality tested to ensure reproducible results in your apoptosis-related experiments.

Application Notes

Optimal dilution of the Bax antibody should be determined by the researcher.

Immunogen

Amino acids 17-48 (EQIMKTGALLLQGFIQDRAGRMGGEAPELALD) from the human protein were used as the immunogen for the Bax antibody.

Storage

After reconstitution, the Bax antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.