- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
B3GNT8 Antibody (R32273)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32273 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q7Z7M8 |
| Localization | Cytoplasmic |
| Applications | Western blot : 0.1-0.5ug/ml IHC (FFPE) : 0.5-1ug/ml |
| Limitations | This B3GNT8 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
B3GNT8 is a galactosyltransferase involved in the synthesis of poly-N-acetyllactosamine (polyLacNAc), a linear chain of repeating LacNAc units made up of galactose (Gal) and N-acetylglucosamine (GlcNAc) with the structure (Gal-beta-1-4-GlcNAc-beta-1-3)n. By genomic sequence analysis, the B3GNT8 gene is mapped to chromosome 19q13.2. It was showed that a soluble form of B3GNT8 overexpressed by transfected HEK293 cells selectively transferred GlcNAc from UDP-GlcNAc to the nonreducing terminus of Gal-beta-1-4-GlcNAc-alpha-p-nitrophenyl phosphate and to lactoside-alpha-benzoyl. It did not utilize keratan sulfates or polylactosamine oligosaccharide as substrate. B3GNT8 activity required Mn(2+) and showed less efficiency with Co(2+). The pH optimum was between 7 and 7.5. B3GNT8 also transferred GlcNAc onto alpha-1-acid glycoprotein and ovomucoid, which possess tetraantennary complex type and pentaantennary complex type N-glycans. With a tetraantennary N-glycan substrate, B3GNT8 appeared to prefer the beta-1-2 branch over the beta-1-6 branch. When overexpressed in HCT15 human colon cancer cells, B3GNT8 increased cell surface expression of both polyLacNAc and beta-1-6-branched N-glycans.
Optimal dilution of the B3GNT8 antibody should be determined by the researcher.
Amino acids ADRTADHCAFRNLLLVRPLGPQASIRLWKQLQDPRLQC of human B3GNT8 were used as the immunogen for the B3GNT8 antibody.
After reconstitution, the B3GNT8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
