• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ATP11C Antibody / Phospholipid-transporting ATPase IG

ATP11C Antibody / Phospholipid-transporting ATPase IG (RQ6040)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6040 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human U-2 OS cells with ATP11C antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human U-2 OS cells with ATP11C antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of human 1) HEK293, 2) K562, 3) PC-3 and 4) HeLa lysate with ATP11C antibody. Predicted molecular weight ~129 kDa.
Flow cytometry testing of human A549 cells with ATP11C antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATP11C antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q8NB49
Localization Cytoplasmic, plasma membrane
Applications Western blot : 0.5-1ug/ml
Immunofluorescence : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This ATP11C antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ATP11C is an enzyme that in humans is encoded by the ATP11C gene. This gene is mapped to Xq27.1.

Application Notes

Optimal dilution of the ATP11C antibody should be determined by the researcher.

Immunogen

Amino acids QNHEIELTKVHVERNAMDGYRTLCVAFKEIAPDDYER from the human protein were used as the immunogen for the ATP11C antibody.

Storage

After reconstitution, the ATP11C antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ATP11C antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.