• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ATG14L Antibody

ATG14L Antibody (R32270)

  Catalog No Formulation Size Price (USD)  
Image R32270 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain and 2) human HeLa lysate with ATG14L antibody. Expected/observed molecular weight ~59 kDa.
IHC testing of FFPE human lung cancer tissue with ATG14L antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat spleen with ATG14L antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human A431 cells with ATG14L antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
Flow cytometry testing of human SiHa cells with ATG14L antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
Flow cytometry testing of human PC-3 cells with ATG14L antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ATG14L antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Immunofluorescent staining of FFPE human lung cancer tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE human colon cancer tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE rat spleen tissue with ATG14L antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q6ZNE5
Localization Cytoplasmic
Applications Western Blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Immunofluorescence : 5ug/ml
Limitations This ATG14L antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

ATG14 (also known as beclin-1-associated autophagy-related key regulator (Barkor) or ATG14L), an essential autophagy-specific regulator of the class III phosphatidylinositol 3-kinase complex, promotes membrane tethering of protein-free liposomes, and enhances hemifusion and full fusion of proteoliposomes reconstituted with the target (t)-SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) syntaxin 17 (STX17) and SNAP29, and the vesicle (v)-SNARE VAMP8 (vesicle-associated membrane protein 8). ATG14 binds to the SNARE core domain of STX17 through its coiled-coil domain, and stabilizes the STX17-SNAP29 binary t-SNARE complex on autophagosomes.

Application Notes

Optimal dilution of the ATG14L antibody should be determined by the researcher.

Immunogen

Amino acids RDRERFIDKKERLSRLKSKQEEFQKEVLKAME of human ATG14L were used as the immunogen for the ATG14L antibody.

Storage

After reconstitution, the ATG14L antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.