• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ATG13 Antibody

ATG13 Antibody (R31833)

  Catalog No Formulation Size Price (USD)  
Image R31833 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
Western blot testing of 1) human HeLa and 2) mouse HEPA lysate with ATG13 antibody. Predicted/observed molecular weight ~57 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O75143
Applications Western blot : 0.1-0.5ug/ml
Limitations This ATG13 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.

Application Notes

Optimal dilution of the ATG13 antibody should be determined by the researcher.


Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody.


After reconstitution, the ATG13 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.