- Tel: 858.663.9055
- Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Autophagy-related protein 13, also known as ATG13, is a protein that in humans is encoded by the KIAA0652 gene. ATG13 is an autophagy factor required for phagosome formation. It is located on 11p11.2. And ATG13 is a target of the TOR kinase signaling pathway that regulates autophagy through phosphorylation of ATG13 and ULK1, and the regulation of the ATG13-ULK1-RB1CC1 complex.
Optimal dilution of the ATG13 antibody should be determined by the researcher.
Amino acids MAEDLDSLPEKLAVHEKNVREFDAFVETLQ of human ATG13 were used as the immunogen for the ATG13 antibody.
After reconstitution, the ATG13 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.