• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ATF4 Antibody

ATF4 Antibody (RQ4441)

  Catalog No Formulation Size Price (USD)  
Image RQ4441 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
IHC testing of FFPE human prostate cancer with ATF4 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC testing of FFPE human ovarian cancer with ATF4 antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of human 1) HeLa, 2) placenta, 3) HepG2, 4) MDA-MB-231 and 5) SW620 lysate with ATF4 antibody at 0.5ug/ml. Predicted molecular weight ~39 kDa, observed here at ~49 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P18848
Localization Cytoplasm
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This ATF4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ATF4, Activating Transcription Factor 4, is also known as CREB2. ATF4 belongs to the large ATF/CREB family of transcription factors which bind DNA via their basic region and dimerize via their leucine zipper domain to form a variety of homo- and heterodimers to regulate gene transcription. It is identified that members of this family share significant sequence similarity within a leucine zipper DNA-binding motif and an adjacent basic region. The ATF4 gene is mapped to chromosome 22. Unlike CREB, which activates transcription from CRE-containing promoters, CREB2 functions as a specific repressor of CRE-dependent transcription. The transcriptional repressor activity resides within the C-terminal leucine zipper and basic domain region of the CREB2 protein.

Application Notes

Optimal dilution of the ATF4 antibody should be determined by the researcher.

Immunogen

Amino acids KELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP were used as the immunogen for the ATF4 antibody.

Storage

After reconstitution, the ATF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.