• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ARID1A Antibody

ARID1A Antibody (R31797)

  Catalog No Formulation Size Price (USD)  
Image R31797 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 389
Western blot testing of human 1) SW620 and 2) HepG2 lysate with ARID1A antibody. Expected/observed molecular weight: 242-270 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O14497
Localization Nuclear
Applications Western blot : 0.1-0.5ug/ml
Limitations This ARID1A antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card


AT-rich interactive domain-containing protein 1A, also known as p270, is a protein that in humans is encoded by the ARID1A gene. This gene encodes a member of the SWI/SNF families, whose members have helicase and ATPase activities and are thought to regulate transcription of certain genes by altering the chromatin structure around those genes. ARID1A is mapped to 1p36.11. It possesses at least two conserved domains that could be important for its function. First, it has a DNA-binding domain that can specifically bind an AT-rich DNA sequence known to be recognized by a SNF/SWI complex at the beta-globin locus. Second, the C-terminus of the protein can stimulate glucocorticoid receptor-dependent transcriptional activation.

Application Notes

Optimal dilution of the ARID1A antibody should be determined by the researcher.


Amino acids KMWVDRYLAFTEEKAMGMTNLPAVGRKPLDLYR of human ARID1A were used as the immunogen for the ARID1A antibody.


After reconstitution, the ARID1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.