• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ARHGEF1 Antibody

ARHGEF1 Antibody (R32513)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32513 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human A431 cells with ARHGEF1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human A431 cells with ARHGEF1 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse lymph tissue with ARHGEF1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat lymph tissue with ARHGEF1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
Western blot testing of 1) rat brain, 2) human HeLa and 3) human Jurkat lysate with ARHGEF1 antibody at 0.5ug/ml. Predicted molecular weight ~102 kDa, but routinely observed at ~115 kDa.
Flow cytometry testing of human A431 cells with ARHGEF1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ARHGEF1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q92888
Localization Cytoplasmic, membranous
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This ARHGEF1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Rho guanine nucleotide exchange factor 1, also called p115-RhoGEF, is a protein that in humans is encoded by the ARHGEF1 gene. Rho GTPases play a fundamental role in numerous cellular processes that are initiated by extracellular stimuli that work through G protein coupled receptors. The encoded protein may form a complex with G proteins and stimulate Rho-dependent signals. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the ARHGEF1 antibody to be titrated for optimal performance.

Immunogen

Amino acids 41-71 (EQNSQFQSLEQVKRRPAHLMALLQHVALQFE) from the human protein were used as the immunogen for the ARHGEF1 antibody.

Storage

After reconstitution, the ARHGEF1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ARHGEF1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.