• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ARC Antibody / Activity-regulated cytoskeleton-associated protein

ARC Antibody / Activity-regulated cytoskeleton-associated protein (R32271)

  Catalog No Formulation Size Price (USD)  
Image R32271 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) rat testis, 3) mouse brain, 4) human PANC, 5) human HeLa and 6) human MCF7 lysate with ARC antibody. Expected/observed molecular weight ~45 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q7LC44
Applications Western blot : 0.1-0.5ug/ml
Limitations This ARC antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.

Application Notes

Optimal dilution of the ARC antibody should be determined by the researcher.

Immunogen

Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.

Storage

After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.