- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
ARC Antibody / Activity-regulated cytoskeleton-associated protein (R32271)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32271 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q7LC44 |
| Applications | Western blot : 0.1-0.5ug/ml |
| Limitations | This ARC antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
Arc is widely considered to be an important protein in neurobiology and also a significant tool for systems neuroscience.
Optimal dilution of the ARC antibody should be determined by the researcher.
Amino acids KLKRFLRHPLPKTLEQLIQRGMEVQDDLEQAAEPA of human ARC were used as the immunogen for the ARC antibody.
After reconstitution, the ARC antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz