• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Aquaporin 1 Antibody / AQP1

Aquaporin 1 Antibody / AQP1 (R32050)

  Catalog No Formulation Size Price (USD)  
Image R32050 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE human bladder urothelial carcinoma tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC testing of FFPE human intestinal cancer with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of FFPE human rectal cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human lung cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC testing of FFPE mouse kidney with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC staining of FFPE rat kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC testing of FFPE rat kidney with Aquaporin 1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Immunofluorescent staining of FFPE human lung cancer tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE rat kidney tissue with Aquaporin 1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) rat kidney, 2) mouse kidney and 3) mouse lung tissue lysate with Aquaporin 1 antibody. Expected molecular weight ~28 kDa.
Flow cytometry testing of human SH-SY5Y cells with Aquaporin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 1 antibody.
Flow cytometry testing of human U-2 OS cells with Aquaporin 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Aquaporin 1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P29972
Localization Membrane
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Aquaporin 1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, FACS
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Human, Mouse
    Pred. Reactivity : Bovine, Rat
  • Applications : WB
    Reactivity : Mouse, Rat

Description

Aquaporin 1 is a 28-kD integral protein thought at first to be a breakdown product of the Rh polypeptide but was later shown to be a unique molecule that is abundant in erythrocytes and renal tubules. AQP1 is also expressed by the choroid plexus and various other tissues. It forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

Application Notes

Optimal dilution of the Aquaporin 1 antibody should be determined by the researcher.

Immunogen

Amino acids DRVKVWTSGQVEEYDLDADDINSRVEMKPK of human Aquaporin 1 were used as the immunogen for the Aquaporin 1 antibody.

Storage

After reconstitution, the Aquaporin 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.