• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AQP9 Antibody / Aquaporin 9

AQP9 Antibody / Aquaporin 9 (RQ4131)

  Catalog No Formulation Size Price (USD)  
Image RQ4131 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Western blot testing of 1) rat liver and 2) mouse liver lysate with AQP9 antibody at 0.5ug/ml. Predicted molecular weight ~32 kDa.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Predicted Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O43315
Applications Western Blot : 0.5-1ug/ml
Limitations This AQP9 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Aquaporin-9 is a protein that in humans is encoded by the AQP9 gene. AQP9 encodes a 295-amino-acid protein with the amino acid sequence identity with AQP3 (48%), AQP7 (45%), and other aquaporins (approximately 30%), suggesting that AQP3, AQP7, and AQP9 belong to a subfamily of the aquaporin family. AQP9 is the major glycerol channel in mouse erythrocytes and suggest that this transport pathway may contribute to the virulence of intraerythrocytic stages of malarial infection.

Application Notes

Optimal dilution of the AQP9 antibody should be determined by the researcher.

Immunogen

Amino acids LVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM from the human protein were used as the immunogen for the AQP9 antibody.

Storage

After reconstitution, the AQP9 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.