• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> APRIL Antibody

APRIL Antibody (R31837)

  Catalog No Formulation Size Price (USD)  
Image R31837 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
Western blot testing of human 1) HeLa, 2) COLO320, 3) SW620, 4) Jurkat, 5) Raji and 6) U937 lysate with APRIL antibody. Expected/observed molecular weight ~28 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O75888
Applications Western blot : 0.1-0.5ug/ml
ELISA : 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating
Limitations This APRIL antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


A proliferation-inducing ligand (APRIL), also known as tumor necrosis factor ligand superfamily member 13 (TNFSF13), is a protein of the TNF superfamily recognized by the cell surface receptor TACI. The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. And this protein is a ligand for TNFRSF17/BCMA, a member of the TNF receptor family. This protein and its receptor are both found to be important for B cell development. In vitro experiments suggested that this protein may be able to induce apoptosis through its interaction with other TNF receptor family proteins such as TNFRSF6/FAS and TNFRSF14/HVEM. Alternative splicing results in multiple transcript variants. Some transcripts that skip the last exon of the upstream gene (TNFSF12) and continue into the second exon of this gene have been identified; such read-through transcripts are contained in GeneID 407977, TNFSF12-TNFSF13.

Application Notes

Optimal dilution of the APRIL antibody should be determined by the researcher.


Amino acids PINATSKDDSDVTEVMWQPALRRGRGLQAQ of human APRIL were used as the immunogen for the APRIL antibody.


After reconstitution, the APRIL antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.