• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> APLP1 Antibody (N-Terminal Region)

APLP1 Antibody (N-Terminal Region) (R32129)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32129 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of 1) rat brain, 2) rat testis, 3) human SGC-7901, 4) 22RV1 and 5) MCF7 lysate with APLP1 antibody. Expected molecular weight: 76 kDa (unmodified), ~86 kDa (soluble/glycosylated form), 92~95 kDa (mature form).
›
Western blot testing of 1) rat brain, 2) rat testis, 3) human SGC-7901, 4) 22RV1 and 5) MCF7 lysate with APLP1 antibody. Expected molecular weight: 76 kDa (unmodified), ~86 kDa (soluble/glycosylated form), 92~95 kDa (mature form).
IHC testing of FFPE mouse brain with APLP1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain with APLP1 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P51693
Localization Cytoplasmic, membrane
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This APLP1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, FACS
    Reactivity : Human
  • Applications : WB, FACS, Direct ELISA
    Reactivity : Human, Mouse, Rat

Description

Amyloid-precursor-like protein 1 (APLP1) is a membrane-associated glycoprotein, whose gene is homologous to the APP gene, which has been shown to be involved in the pathogenesis of Alzheimer's disease. APLP1 is predominantly expressed in brain, particularly in the cerebral cortex postsynaptic density. The human gene has been mapped to chromosomal region 19q13.1. The gene is 11.8 kb long and contains 17 exons. APLP1 has been considered a candidate gene for CNF. All exon regions of the gene were amplified by the polymerase chain reaction and sequenced from DNA of CNF patients. No differences were observed between CNF patients and controls, suggesting that mutations in APLP1 are not involved in the etiology of CNF.

Application Notes

Optimal dilution of the APLP1 antibody should be determined by the researcher.

Immunogen

Amino acids 82-112 (RRCLRDPQRVLEYCRQMYPELQIARVEQATQ) of human APLP1 were used as the immunogen for the APLP1 antibody.

Storage

After reconstitution, the APLP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all APLP1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.