• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> APH1A Antibody

APH1A Antibody (R32302)

  Catalog No Formulation Size Price (USD)  
Image R32302 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
Western blot testing of 1) mouse lung, 2) mouse liver, 3) human SW620, 4) SMMC and 5) human placenta lysate using APH1A antibody. Expected/observed molecular weight: 27~29 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q96BI3
Applications Western blot : 0.1-0.5ug/ml
Limitations This APH1A antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Dog, Pig, Cow


APH1A encodes a component of the gamma secretase complex that cleaves integral membrane proteins such as Notch receptors and beta-amyloid precursor protein. The gamma secretase complex contains this gene product, or the paralogous anterior pharynx defective 1 homolog B (APH1B), along with the presenilin, nicastrin, and presenilin enhancer-2 proteins. The precise function of this seven-transmembrane-domain protein is unknown though it is suspected of facilitating the association of nicastrin and presenilin in the gamma secretase complex as well as interacting with substrates of the gamma secretase complex prior to their proteolytic processing. Polymorphisms in a promoter region of this gene have been associated with an increased risk for developing sporadic Alzheimer's disease. Alternative splicing results in multiple protein-coding and non-protein-coding transcript variants.

Application Notes

Optimal dilution of the APH1A antibody should be determined by the researcher.


Amino acids LRSIQRSLLCRRQEDSRVMVYSALRIPPED of human APH1A were used as the immunogen for the APH1A antibody.


After reconstitution, the APH1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.