• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> APC2 Antibody

APC2 Antibody (R32509)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32509 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human HeLa lysate with APC2 antibody at 0.5ug/ml. N-terminal APC2 antibodies generally show three bands above 200 kDa and may show three degradation or splice variant forms at ~121, 81 and 51 kDa (Ref. 1).
Western blot testing of human HeLa lysate with APC2 antibody at 0.5ug/ml. N-terminal APC2 antibodies generally show three bands above 200 kDa and may show three degradation or splice variant forms at ~121, 81 and 51 kDa (Ref. 1).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O95996
Applications Western blot : 0.5-1ug/ml
Limitations This APC2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, IF, FACS, Direct ELISA
    Reactivity : Human, Mouse, Rat

Description

APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the APC2 antibody to be titrated for optimal performance.

Immunogen

Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.

Storage

After reconstitution, the APC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all APC2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.