• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> APC2 Antibody

APC2 Antibody (R32509)

  Catalog No Formulation Size Price (USD)  
Image R32509 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
Western blot testing of human HeLa lysate with APC2 antibody at 0.5ug/ml. N-terminal APC2 antibodies generally show three bands above 200 kDa and may show three degradation or splice variant forms at ~121, 81 and 51 kDa (Ref. 1).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O95996
Applications Western blot : 0.5-1ug/ml
Limitations This APC2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


APC2, also called APCL or Adenomatous polyposis coli protein-like, is a deduced 2,303-amino acid protein that contains an N-terminal coiled-coil domain, followed by an armadillo domain and five 20-amino acid repeats. The human APC2 gene is mapped to chromosome 19p13.3. It is found that the 20-amino acid repeat domain of APCL could bind beta-catenin (CTNNB1) and deplete the intracellular beta-catenin pool. A reporter gene assay revealed that APCL could regulate interaction of beta-catenin with T cell-specific transcription factors (TCF7), although less efficiently than APC.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the APC2 antibody to be titrated for optimal performance.


Amino acids 51-90 (KHLQGKLEQEARVLVSSGQTEVLEQLKALQMDITSLYNLK) from the human protein were used as the immunogen for the APC2 antibody.


After reconstitution, the APC2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.