• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Anti-CD19 Antibody

Anti-CD19 Antibody (R31973)

  Catalog No Formulation Size Price (USD)  
Image R31973 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of human 1) Raji, 2) A549, 3) MCF7, and 4) SW620 cell lysate with anti-CD19 antibody. Expected molecular weight: 60~100 kDa depending on glycosylation level.
IHC testing of FFPE human tonsil with anti-CD19 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P15391
Localization Cell surface, cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This anti-CD19 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

B-lymphocyte antigen CD19, also known as CD19 (Cluster of Differentiation 19), is a protein that in humans is encoded by the CD19 gene. It is found on the surface of B-cells, a type of white blood cell. Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen receptors. The CD19 gene encodes a cell surface molecule that assembles with the antigen receptor of B lymphocytes in order to decrease the threshold for antigen receptor-dependent stimulation.

Application Notes

Optimal dilution of the anti-CD19 antibody should be determined by the researcher.

Immunogen

Amino acids LVGILHLQRALVLRRKRKRMTDPTRRFFKVT of human CD19 were used as the immunogen for the anti-CD19 antibody.

Storage

After reconstitution, the anti-CD19 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.