• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Annexin VIII Antibody

Annexin VIII Antibody (R32683)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32683 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa and 2) A549 cell lysate with Annexin VIII antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
›
Western blot testing of human 1) HeLa and 2) A549 cell lysate with Annexin VIII antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
Flow cytometry testing of human U-2 OS cells with Annexin VIII antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Annexin VIII antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P13928
Applications Western blot : 0.5-1ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This Annexin VIII antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human, Mouse, Rat
  • Applications : IHC-P
    Reactivity : Human
  • Applications : WB, IHC-P, ICC
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, IHC-F
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, IHC-F
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, IF, FACS
    Reactivity : Human
  • Applications : WB, IHC-P, IHC-F, IF, FACS
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC, FACS, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Primate
  • Applications : WB, IHC, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Mouse
    Pred. Reactivity : Rat, Pig, Cow
  • Applications : WB, IHC, ELISA (peptide)
    Reactivity : Human
  • Applications : WB, IHC, ELISA (peptide)
    Reactivity : Human
  • Applications : WB, IHC-P, IF, FACS, ELISA
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse

Description

ANXA8 is also known as Annexin VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Application Notes

Optimal dilution of the Annexin VIII antibody should be determined by the researcher.

Immunogen

Amino acids 20-61 (HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQIAK) from the human protein were used as the immunogen for the Annexin VIII antibody.

Storage

After reconstitution, the Annexin VIII antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Annexin VIII antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.