- Tel: 858.663.9055
- 
									 Email: info@nsjbio.com Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
 Email: info@nsjbio.com
Email: info@nsjbio.com
								Related Products
| 
 | 
Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.
Optimal dilution of the ANGPTL4 antibody should be determined by the researcher.
Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein were used as the immunogen for the ANGPTL4 antibody.
After reconstitution, the ANGPTL4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
 
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.