• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ANGPTL4 Antibody

ANGPTL4 Antibody (R32788)

  Catalog No Formulation Size Price (USD)  
Image R32788 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 389
Western blot testing of recombinant human ANGPTL4 protein (1ng/lane) with ANGPTL4 antibody at 0.5ug/ml. Expected molecular weight: 50-55 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9BY76
Applications Western Blot : 0.5-1ug/ml
ELISA : 0.1-0.5ug/ml (human protein tested; request BSA-free format for coating)
Limitations This ANGPTL4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.

Application Notes

Optimal dilution of the ANGPTL4 antibody should be determined by the researcher.


Amino acids 369-406 (QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS) from the human protein were used as the immunogen for the ANGPTL4 antibody.


After reconstitution, the ANGPTL4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.