• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ANGPTL3 Antibody

ANGPTL3 Antibody (RQ4118)

  Catalog No Formulation Size Price (USD)  
Image RQ4118 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of mouse HEPA1-6 cell lysate with ANGPTL3 antibody at 0.5ug/ml. Expected molecular weight 50 ~ 63 kDa depending on glycosylation level.
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9Y5C1
Applications Western Blot : 0.5-1ug/ml
Limitations This ANGPTL3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA
    Reactivity : Human, Mouse

Description

ANGPTL3 (Angiopoietin-Like 3), also known as ANGPT5, is a protein which in humans is encoded by the ANGPTL3 gene. The protein encoded by this gene is a member of the angiopoietin-like family of secreted factors. By radiation hybrid mapping and the use of surrounding genes, this gene is mapped to chromosome 1p31. It is predominantly expressed in the liver, and has the characteristic structure of angiopoietins, consisting of a signal peptide, N-terminal coiled-coil domain and the C-terminal fibrinogen (FBN)-like domain. Angptl3 also acts as dual inhibitor of lipoprotein lipase (LPL) and endothelial lipase (EL), and increases plasma triglyceride and HDL cholesterol in rodents. ANGPTL3 inhibit endothelial lipase to catalyze HDL-phospholipid and increase HDL-PL levels.

Application Notes

Optimal dilution of the ANGPTL3 antibody should be determined by the researcher.

Immunogen

Amino acids RFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLN from the human protein were used as the immunogen for the ANGPTL3 antibody.

Storage

After reconstitution, the ANGPTL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.