• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Angiotensin II type-2 receptor Antibody [Discontinued, view replacements]

Angiotensin II type-2 receptor Antibody [Discontinued, view replacements] (R32119)

  Catalog No Formulation Size Price (USD)  
Image R32119 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 299
Western blot testing of 1) rat liver and 2) human HeLa lysate with Angiotensin II type-2 receptor antibody. Predicted/observed molecular weight ~47 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P50052
Applications Western blot : 0.1-0.5ug/ml
Limitations This Angiotensin II type-2 receptor antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

AGTR2 is also known as angiotensin II receptor, type 2. The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. The human AGTR2 gene is composed of three exons and spans at least 5 kb. Exons 1 and 2 encode for 5' untranslated mRNA sequence and exon 3 harbors the entire uninterrupted open reading frame.

Application Notes

Optimal dilution of the Angiotensin II type-2 receptor antibody should be determined by the researcher.

Immunogen

Amino acids FRVPITWLQGKRESMSCRKSSSLREMETFVS of human AGTR2 were used as the immunogen for the Angiotensin II type-2 receptor antibody.

Storage

After reconstitution, the Angiotensin II type-2 receptor antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.