• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> AMACR Antibody

AMACR Antibody (R32468)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32468 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat kidney, 2) rat liver and 3) human HepG2 lysate with AMACR antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.
Western blot testing of 1) rat kidney, 2) rat liver and 3) human HepG2 lysate with AMACR antibody at 0.5ug/ml. Predicted molecular weight ~43 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q9UHK6
Applications Western blot : 0.5-1ug/ml
Limitations This AMACR antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Alpha-methylacyl-CoA racemase (AMACR) is a mitochondrial and peroxisomal enzyme. It encodes a racemase. The encoded enzyme interconverts pristanoyl-CoA and C27-bile acylCoAs between their (R)- and (S)-stereoisomers. The conversion to the (S)-stereoisomers is necessary for degradation of these substrates by peroxisomal beta-oxidation. Encoded proteins from this locus localize to both mitochondria and peroxisomes. Mutations in this gene may be associated with adult-onset sensorimotor neuropathy, pigmentary retinopathy, and adrenomyeloneuropathy due to defects in bile acid synthesis. Alternatively spliced transcript variants have been described. Read-through transcription also exists between this gene and the upstream neighboring C1QTNF3 (C1q and tumor necrosis factor related protein 3) gene.

Application Notes

Optimal dilution of the AMACR antibody should be determined by the researcher.

Immunogen

Amino acids RGQNMLDGGAPFYTTYRTADGEFMAVGAIEPQFYELLIK from the human protein were used as the immunogen for the AMACR antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the AMACR antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all AMACR antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.