• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Alpha Defensin 1 Antibody / DEFA1

Alpha Defensin 1 Antibody / DEFA1 (R32739)

  Catalog No Formulation Size Price (USD)  
Image R32739 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 389
Western blot testing of 1) rat testis and 2) human HeLa lysate with Alpha Defensin 1 antibody at 0.5ug/ml. Predicted molecular weight ~10 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P59665
Applications Western Blot : 0.5-1ug/ml
Limitations This Alpha Defensin 1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

Application Notes

Optimal dilution of the Alpha Defensin 1 antibody should be determined by the researcher.


Amino acids 65-94 (ACYCRIPACIAGERRYGTCIYQGRLWAFCC) from the human protein were used as the immunogen for the Alpha Defensin 1 antibody.


After reconstitution, the Alpha Defensin 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.