• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ALDH7A1 Antibody

ALDH7A1 Antibody (R32506)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32506 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat liver, 2) mouse HEPA and 3) human HeLa lysate with ALDH7A1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.
›
Western blot testing of 1) rat liver, 2) mouse HEPA and 3) human HeLa lysate with ALDH7A1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.
IHC testing of FFPE human lung with ALDH7A1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat brain with ALDH7A1 antibody at 1ug/ml. HIER: steam sections in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human U-2 OS cells with ALDH7A1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IF/ICC staining of FFPE human U-2 OS cells with ALDH7A1 antibody (green) at 2ug/ml and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of permeabilized human A431 cells with ALDH7A1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ALDH7A1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P49419
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescenc/Immunocytochemistry (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This ALDH7A1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Aldehyde dehydrogenase 7 family, member A1, also known as ALDH7A1 or antiquitin, is an enzyme that in humans is encoded by the ALDH7A1 gene. The protein encoded by this gene is a member of subfamily 7 in the aldehyde dehydrogenase gene family. These enzymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism andlipid peroxidation. This particular member has homology to a previously described protein from the green garden pea, the 26g pea turgor protein. It is also involved in lysine catabolism that is known to occur in the mitochondrial matrix. Recent reports show that this protein is found both in the cytosol and the mitochondria, and the two forms likely arise from the use of alternative translation initiation sites. An additional variant encoding a different isoform has also been found for this gene. Mutations in this gene are associated with pyridoxine-dependent epilepsy. Several related pseudogenes have also been identified.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the ALDH7A1 antibody to be titrated for optimal performance.

Immunogen

Amino acids 333-369 (ARRLFIHESIHDEVVNRLKKAYAQIRVGNPWDPNVLY) from the human protein were used as the immunogen for the ALDH7A1 antibody.

Storage

After reconstitution, the ALDH7A1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ALDH7A1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.