• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ALDH2 Antibody

ALDH2 Antibody (R31890)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31890 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Immunofluorescent staining of FFPE human U-2 OS cells with ALDH2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human U-2 OS cells with ALDH2 antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE human kidney cancer tissue with ALDH2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat liver tissue with ALDH2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) rat kidney and 2) mouse kidney lysate with ALDH2 antibody. Predicted/observed molecular weight ~56 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P05091
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 0.5-1ug/ml
Immunofluorescence : 2-4ug/ml
Limitations This ALDH2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC, FACS, IF, WB, ELISA
    Reactivity : Human
  • Applications : WB
    Reactivity : Human
    Rab Mono Image
  • Applications : WB, FACS, IF
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Rat
  • Applications : WB, ELISA (peptide), EIA
    Reactivity : Human, Mouse, Rat
    Pred. Reactivity : Cow, Dog, Pig
  • Applications : WB, ELISA (peptide), EIA
    Reactivity : Human, Mouse, Rat
    Pred. Reactivity : Cow, Dog, Pig

Description

ALDH2 (Aldehyde Dehydrogenase 2 Family) is a human gene. The enzyme encoded by this gene belongs to the aldehyde dehydrogenase family of enzymes that catalyze the chemical transformation from acetaldehyde to acetic acid. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Hsu et al. (1985) assigned the ALDH2 locus to chromosome 12 by means of a cDNA probe and Southern blot analysis of somatic cell hybrids. Using an unbiased proteomic search, Chen et al. (2008) identified mitochondrial ALDH2 as an enzyme whose activation correlated with reduced ischemic heart damage in rodent models. A high-throughput screen identified a small molecule activator of ALDH2, which they called Alda-1, that, when administered to rats before an ischemic event, reduced infarct size by 60%, most likely through its inhibitory effect on the formation of cytotoxic aldehydes.

Application Notes

Optimal dilution of the ALDH2 antibody should be determined by the researcher.

Immunogen

Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA of human ALDH2 were used as the immunogen for the ALDH2 antibody.

Storage

After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ALDH2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.