- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ALDH2 antibody recognizes Acetaldehyde dehydrogenase 2, a mitochondrial enzyme encoded by the ALDH2 gene on chromosome 12q24.12. ALDH2 belongs to the aldehyde dehydrogenase superfamily and catalyzes the oxidation of acetaldehyde and other reactive aldehydes into their corresponding carboxylic acids. This detoxifying reaction is essential for ethanol metabolism, oxidative stress regulation, and protection against lipid peroxidation byproducts such as 4-hydroxynonenal. ALDH2 is highly expressed in liver, heart, skeletal muscle, brain, and gastrointestinal tissues, reflecting its broad role in cellular redox balance. The protein localizes to the mitochondrial matrix, where it co-localizes with enzymes of the citric acid cycle, oxidative phosphorylation complexes, and mitochondrial detoxification pathways.
Acetaldehyde dehydrogenase 2 plays a central role in intermediary metabolism. During ethanol metabolism, ALDH2 converts acetaldehyde into acetate, preventing toxic accumulation that can lead to cellular damage, inflammation, and metabolic dysregulation. In addition to ethanol-derived substrates, ALDH2 detoxifies lipid peroxidation aldehydes and environmental aldehydes generated by pollutants and oxidative stress. ALDH2 also contributes to pathways involving nitric oxide signaling, cardiovascular protection, and mitochondrial resilience during hypoxic or ischemic stress. The enzyme is a key regulator in cardiomyocyte survival, where its detoxifying activity supports mitochondrial integrity and reduces oxidative injury.
The well-characterized ALDH2*2 variant, common in East Asian populations, results from a single amino acid substitution that impairs enzymatic activity. Individuals carrying this variant exhibit reduced acetaldehyde clearance, leading to flushing responses after alcohol consumption and an elevated risk for conditions including esophageal cancer, cardiovascular dysfunction, and alcohol-related tissue damage. This variant has provided important insight into the physiological impact of ALDH2 dysfunction and continues to be a prominent area of biomedical research. Additional alterations in ALDH2 expression or activity have been linked to neurodegenerative processes, metabolic disorders, and age-associated oxidative stress.
At the molecular level, ALDH2 functions as a homotetramer, with each subunit contributing to catalytic efficiency and cofactor binding. Isoform diversity arises from alternative transcriptional regulation, and post-translational modifications such as phosphorylation and oxidation influence enzyme stability and mitochondrial localization. During development, ALDH2 expression increases in metabolically active tissues as mitochondrial capacity expands, highlighting its importance in early energy metabolism. In adult tissues, ALDH2 is induced by metabolic cues, stress responses, and lipid oxidation states.
This ALDH2 / Acetaldehyde dehydrogenase 2 Antibody is suitable for detecting Acetaldehyde dehydrogenase 2 in research focused on ethanol metabolism, mitochondrial detoxification pathways, cardiovascular biology, oxidative stress responses, toxicology, and metabolic disease models. It supports studies examining redox homeostasis, aldehyde clearance, mitochondrial adaptation, and tissue-specific regulation of aldehyde dehydrogenase activity. NSJ Bioreagents includes this reagent in its metabolism and mitochondrial biology antibody collection.
Explore our ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody page for additional information on this key regulator of aldehyde metabolism, mitochondrial function, and oxidative stress protection.
Optimal dilution of the ALDH2 / Acetaldehyde dehydrogenase 2 antibody should be determined by the researcher.
Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA of human ALDH2 were used as the immunogen for the ALDH2 / Acetaldehyde dehydrogenase 2 antibody.
After reconstitution, the ALDH2 / Acetaldehyde dehydrogenase 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.