- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody recognizes aldehyde dehydrogenase 2 (ALDH2), a mitochondrial enzyme that plays a central role in cellular detoxification and metabolic homeostasis. ALDH2 catalyzes the oxidation of aldehydes to their corresponding carboxylic acids, thereby eliminating potentially toxic intermediates generated during normal metabolism and oxidative stress. The enzyme is best known for its role in converting acetaldehyde, a toxic byproduct of ethanol metabolism, into acetate. However, ALDH2 also detoxifies a broad range of endogenous aldehydes produced through lipid peroxidation and cellular injury. This mouse monoclonal antibody clone 5G7 provides specific detection of ALDH2 in a variety of research applications.
ALDH2 is highly expressed in metabolically active tissues including liver, heart, kidney, skeletal muscle, and brain, where mitochondrial integrity is essential for normal cellular function. By removing reactive aldehydes, ALDH2 protects proteins, nucleic acids, and membrane lipids from damage. This detoxification activity helps maintain mitochondrial function and prevents accumulation of oxidative stress-related byproducts. ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody is useful for studying pathways involved in cellular defense, energy metabolism, and mitochondrial homeostasis. Increasing evidence suggests that ALDH2 also contributes to protection against ischemic injury and other stress-induced cellular insults.
Genetic variation in ALDH2 has significant clinical relevance. The ALDH2*2 variant, common in East Asian populations, markedly reduces enzymatic activity and results in impaired acetaldehyde metabolism. Individuals carrying this variant often experience alcohol flushing and may exhibit altered susceptibility to cardiovascular disease, cancer, and metabolic disorders. Beyond alcohol metabolism, reduced ALDH2 activity has been associated with increased oxidative stress, mitochondrial dysfunction, and tissue injury. ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody is therefore valuable for investigations of genetic variation, toxicology, and mechanisms underlying oxidative damage.
ALDH2 has also emerged as an important factor in cardiovascular biology, neurodegeneration, aging, and cancer research. Reactive aldehydes generated during oxidative stress contribute to many chronic diseases, and ALDH2-mediated detoxification can influence disease progression and therapeutic response. Pharmacologic activation of ALDH2 is being explored as a potential strategy for reducing tissue injury and improving mitochondrial function. ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody supports studies of aldehyde metabolism, oxidative stress, mitochondrial biology, toxicology, and disease pathogenesis. Researchers frequently use ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody to examine detoxification pathways, cellular stress responses, and mechanisms that preserve tissue function under physiologic and pathologic conditions.
Learn more about enzymes involved in cellular metabolism, mitochondrial function, and oxidative stress responses on our Metabolism Antibodies page.
Optimal dilution of the ALDH2 Antibody / Mitochondrial Detoxification Enzyme Antibody should be determined by the researcher.
Amino acids SAAATQAVPAPNQQPEVFCNQIFINNEWHDA were used as the immunogen for the ALDH2 antibody.
After reconstitution, the ALDH2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
ALDH2 antibody, Aldehyde Dehydrogenase 2 antibody, Mitochondrial ALDH antibody, Acetaldehyde Dehydrogenase antibody, ALDH-E2 antibody, Mitochondrial Detoxification Enzyme antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.