• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AKR1D1 Antibody

AKR1D1 Antibody [clone 6I4] (RQ5641)

  Catalog No Formulation Size Price (USD)  
Image RQ5641 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
IHC staining of FFPE human liver cancer with AKR1D1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human liver cancer with AKR1D1 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) HepG2, 2) HL-60, 3) ThP-1 and 4) rat liver, 5) rat RH35, 6) mouse liver and 7) mouse HEPA1-6 lysate with AKR1D1 antibody. Predicted molecular weight ~37 kDa.
Flow cytometry testing of human HepG2 cells with AKR1D1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AKR1D1 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Monoclonal
Isotype Mouse IgG2b
Clone Name 6I4
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P51857
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry : 1-2ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This AKR1D1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

Application Notes

Optimal dilution of the AKR1D1 antibody should be determined by the researcher.

Immunogen

Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody.

Storage

After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.