• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> AKR1D1 Antibody / Aldo-keto reductase family 1 member D1

AKR1D1 Antibody / Aldo-keto reductase family 1 member D1 (RQ4911)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4911 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Flow cytometry testing of fixed and permeabilized human HepG2 cells with AKR1D1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AKR1D1 antibody.
›
Flow cytometry testing of fixed and permeabilized human HepG2 cells with AKR1D1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AKR1D1 antibody.
Western blot testing of 1) human HepG2, 2) human Caco-2, 3) rat liver and 4) mouse liver tissue lysate with AKR1D1 antibody at 0.5ug/ml. Predicted molecular weight ~37 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P51857
Applications Western blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This AKR1D1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, FACS
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P, FACS, IF
    Reactivity : Human, Mouse, Rat

Description

Human delta(4)-3-oxosteroid 5-beta-reductase (steroid 5-beta-reductase) catalyzes 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. This gene is mapped to 7q33. The enzyme encoded by this gene is responsible for the catalysis of the 5-beta-reduction of bile acid intermediates and steroid hormones carrying a delta(4)-3-one structure. Deficiency of this enzyme may contribute to hepatic dysfunction. Three transcript variants encoding different isoforms have been found for this gene. Other variants may be present, but their full-length natures have not been determined yet.

Application Notes

Optimal dilution of the AKR1D1 antibody should be determined by the researcher.

Immunogen

Amino acids EEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY from the human protein were used as the immunogen for the AKR1D1 antibody.

Storage

After reconstitution, the AKR1D1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all AKR1D1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.