• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AKAP2 Antibody

AKAP2 Antibody (R32805)

  Catalog No Formulation Size Price (USD)  
Image R32805 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
Western blot testing of 1) rat heart and 2) human HepG2 lysate with AKAP2 antibody at 0.5ug/ml. Predicted molecular weight ~95 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9Y2D5
Applications Western Blot : 0.5-1ug/ml
Limitations This AKAP2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card


A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the AKAP2 antibody should be determined by the researcher.


Amino acids 813-852 (ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYAN) from the human protein were used as the immunogen for the AKAP2 antibody.


After reconstitution, the AKAP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.