• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AK1 Antibody / Adenylate Kinase 1

AK1 Antibody / Adenylate Kinase 1 (R32501)

  Catalog No Formulation Size Price (USD)  
Image R32501 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human U-2 OS cells with AK1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human A431 cells with AK1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AK1 antibody.
Western blot testing of 1) rat skeletal muscle, 2) mouse heart and 3) human COLO320 lysate with ADO antibody at 0.5ug/ml. Predicted molecular weight ~22 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P00568
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Immunofluorescence (FFFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This AK1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

This gene encodes an adenylate kinase enzyme involved in energy metabolism and homeostasis of cellular adenine nucleotide ratios in different intracellular compartments. This gene is highly expressed in skeletal muscle, brain and erythrocytes. Certain mutations in this gene resulting in a functionally inadequate enzyme are associated with a rare genetic disorder causing nonspherocytic hemolytic anemia. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the AK1 antibody to be titrated for optimal performance.

Immunogen

Amino acids 149-189 (RLETYYKATEPVIAFYEKRGIVRKVNAEGSVDSVFSQVCTH) from the human protein were used as the immunogen for the AK1 antibody.

Storage

After reconstitution, the AK1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.