• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AHSG Antibody / Fetuin-A

AHSG Antibody / Fetuin-A (R31869)

  Catalog No Formulation Size Price (USD)  
Image R31869 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain, 2) human RH35 and 3) human MCF7 lysate with AHSG antibody. Expected molecular weight ~39 (unmodified), 45-55 kDa (glycosylated).
IHC testing of FFPE human liver cancer tissue with AHSG antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Flow cytometry testing of human HepG2 cells with AHSG antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AHSG antibody.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P02765
Localization Secreted
Applications Western Blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
ELISA : 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating
Limitations This AHSG antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

Application Notes

Optimal dilution of the AHSG antibody should be determined by the researcher.

Immunogen

Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.

Storage

After reconstitution, the AHSG antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.