• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AGO4 Antibody / RNA Silencing Protein Antibody

AGO4 Antibody / RNA Silencing Protein Antibody (R32464)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32464 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
›
AGO4 Antibody Human Endometrial Cancer IHC. Immunohistochemistry analysis of FFPE human endometrial cancer tissue using AGO4 Antibody / RNA Silencing Protein Antibody. Heat induced antigen retrieval was performed using pH 8 EDTA buffer, and the tissue section was incubated with the primary antibody at 2 ug/ml overnight at 4°C. HRP-conjugated secondary antibody and DAB substrate were used for detection. Cytoplasmic staining is observed in tumor cells, supporting the use of AGO4 Antibody / RNA Silencing Protein Antibody for studying RNA silencing pathways, microRNA regulation and cancer-associated gene expression mechanisms.
AGO4 Antibody Human Cell Line WB. Western blot analysis of human cell lysates using AGO4 Antibody / RNA Silencing Protein Antibody. Lane 1: HeLa cells; Lane 2: 293T cells; Lane 3: Jurkat cells. A specific band is detected at approximately 100 kDa, consistent with the expected molecular weight of AGO4 at approximately 97 kDa. These results support the use of AGO4 Antibody / RNA Silencing Protein Antibody for studying Argonaute family proteins, RNA silencing pathways and microRNA-mediated gene regulation.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9HCK5
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations This AGO4 Antibody / RNA Silencing Protein Antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

AGO4 Antibody / RNA Silencing Protein Antibody detects a member of the Argonaute protein family involved in RNA-mediated gene regulation. AGO4, also known as Argonaute 4 and encoded by the EIF2C4 gene, participates in pathways that use small RNA molecules to control gene expression after transcription. Argonaute proteins are core components of RNA-induced silencing complexes (RISC), where they interact with microRNAs and other small regulatory RNAs to guide sequence-specific recognition of target transcripts. Through these mechanisms, AGO4 contributes to RNA silencing, post-transcriptional regulation and cellular control of protein expression.

AGO4 functions as part of the broader RNA interference pathway that allows cells to fine-tune gene activity. Small RNA molecules associate with Argonaute proteins to direct regulatory complexes toward complementary RNA targets, influencing transcript stability and translation. These processes are essential for maintaining normal cellular function, regulating developmental pathways and controlling responses to changing biological conditions. An AGO4 Antibody / RNA Silencing Protein Antibody is useful for researchers studying RNA biology, gene regulation mechanisms and small RNA-associated pathways.

Research involving AGO4 has provided insight into the specialized functions of different Argonaute family members. While multiple Argonaute proteins participate in RNA silencing networks, individual family members may display differences in expression patterns, regulatory interactions and biological functions. Analysis of AGO4 expression helps researchers investigate microRNA pathways, RISC-associated proteins and mechanisms controlling post-transcriptional gene regulation.

AGO4 is also studied in areas related to cancer biology, developmental regulation and cellular adaptation because changes in RNA regulatory networks can influence important cellular processes. Altered microRNA signaling and gene silencing pathways may affect proliferation, differentiation and stress response mechanisms. Understanding AGO4 function contributes to broader studies examining how RNA-based regulation shapes cellular behavior and disease-associated signaling pathways.

NSJ Bioreagents offers AGO4 Antibody / RNA Silencing Protein Antibody products for researchers studying RNA interference, Argonaute proteins and gene expression regulation. These antibodies support applications including Western blot, immunohistochemistry and immunofluorescence analysis of AGO4 expression and localization. AGO4 Antibody / RNA Silencing Protein Antibody provides a valuable tool for investigating RISC complex biology, microRNA-mediated regulation and RNA silencing mechanisms.

Explore additional gene regulation research tools in our Epigenetics Antibodies page, including targets involved in RNA silencing, transcriptional control and epigenetic regulatory pathways.

Application Notes

Optimal dilution of the AGO4 Antibody / RNA Silencing Protein Antibody should be determined by the researcher.

Immunogen

Amino acids KDQTFKVSVQWVSVVSLQLLLEALAGHLNEVPDDSVQALD from the human protein were used as the immunogen for the AGO4 antibody.

Storage

Prior to reconstitution, store at 4oC. After reconstitution, the AGO4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

Argonaute 4 antibody, EIF2C4 antibody, Argonaute RISC Component 4 antibody, Eukaryotic Translation Initiation Factor 2C 4 antibody, AGO4 Protein antibody, RNA Interference Protein antibody, RISC Complex Protein antibody

Related Products

   1.   View all Ago4 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.