- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Protein argonaute-2, also known as AGO2, is a protein that in humans is encoded by the EIF2C2 gene. This gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-mediated gene silencing. Multiple transcript variants encoding different isoforms have been found for this gene.
Optimal dilution of the AGO2 antibody should be determined by the researcher.
Amino acids KVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHL from the human protein were used as the immunogen for the AGO2 antibody.
Prior to reconstitution, store at 4oC. After reconstitution, the AGO2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.