• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> AGO1 Antibody / Argonaute 1

AGO1 Antibody / Argonaute 1 (R32801)

  Catalog No Formulation Size Price (USD)  
Image R32801 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
IHC testing of FFPE human breast cancer tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat spleen tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat lung tissue with AGO1 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) rat brain, 2) rat kidney, 3) rat NRK, 4) mouse brain, 5) mouse kidney, 6) human HeLa, 7) human Jurkat and 8) human K562 lysate with AGO1 antibody at 0.5ug/ml. Predicted molecular weight ~97 kDa.
Flow cytometry testing of human HL60 cells with AGO1 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue=AGO1 antibody.
Immunofluorescent staining of FFPE human U-2 OS cells with AGO1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9UL18
Applications Western blot : 0.5-1ug/ml
Flow cytometry : 1-3ug/10^6 cells
Immunohistochemistry (FFPE) : 1-2ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Limitations This AGO1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.

Application Notes

Optimal dilution of the AGO1 antibody should be determined by the researcher.


Amino acids 376-409 (EISRLMKNASYNLDPYIQEFGIKVKDDMTEVTGR) from the human protein were used as the immunogen for the AGO1 antibody.


After reconstitution, the AGO1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.