• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> AFF4 Antibody

AFF4 Antibody [clone 8G12] (RQ6288)

Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ6288 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) HepG2, 3) Caco-2, 4) HEK293, 5) MDA-MB-453, 6) PANC-1 and 7) SW620 cell lysate with AFF4 antibody. Predicted molecular weight ~127/98/39 kDa (isoforms 1/2/3).
›
Western blot testing of human 1) HeLa, 2) HepG2, 3) Caco-2, 4) HEK293, 5) MDA-MB-453, 6) PANC-1 and 7) SW620 cell lysate with AFF4 antibody. Predicted molecular weight ~127/98/39 kDa (isoforms 1/2/3).
Flow cytometry testing of human 293T cells with AFF4 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= AFF4 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 8G12
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9UHB7
Applications Western blot : 1-2ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This AFF4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

The AFF4 gene encodes a scaffold protein that functions as a core component of the super elongation complex (SEC), which is involved in transcriptional regulation during embryogenesis. The protein encoded by this gene belongs to the AF4 family of transcription factors involved in leukemia. It is a component of the positive transcription elongation factor b (P-TEFb) complex. This gene is mapped to chromosome 5q31.

Application Notes

Optimal dilution of the AFF4 antibody should be determined by the researcher.

Immunogen

Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 antibody.

Storage

After reconstitution, the AFF4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all AFF4 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.