- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
MLLT5-Associated Factor 1 Antibody / AFF4 Antibody recognizes AFF4, a nuclear regulatory protein that serves as the central scaffold of the Super Elongation Complex (SEC). By coordinating the assembly of transcription elongation factors, including positive transcription elongation factor b and ELL family proteins, AFF4 promotes productive RNA polymerase II transcription. This activity is essential for the regulated expression of genes involved in development, cellular differentiation, and responses to environmental stimuli.
AFF4 is expressed in a variety of tissues and is localized primarily within the nucleus, where it helps organize large multiprotein complexes responsible for transcriptional elongation. As the structural core of the SEC, AFF4 facilitates interactions among numerous transcriptional regulators, allowing rapid activation of genes that require tightly controlled expression. An MLLT5-Associated Factor 1 Antibody is therefore valuable for studies examining nuclear protein complexes, chromatin-associated regulatory mechanisms, and transcriptional control.
Abnormal regulation of AFF4 has been linked to leukemia driven by KMT2A (formerly MLL) rearrangements, as well as developmental disorders and other diseases involving altered transcriptional programs. Because the Super Elongation Complex also participates in viral transcription and stem cell biology, AFF4 continues to attract interest across multiple areas of biomedical research. Understanding its molecular interactions may provide insight into both normal gene regulation and disease-associated transcriptional dysregulation.
A MLLT5-Associated Factor 1 Antibody is a useful reagent for investigating AFF4 expression, Super Elongation Complex assembly, RNA polymerase II transcription elongation, chromatin-associated protein interactions, and nuclear gene regulation.
Learn more about AFF4 biology, its role in the Super Elongation Complex, and our AFF4 Antibody / AF4/FMR2 Family Member 4 Antibody page for additional validation data and research resources.
Optimal dilution of the MLLT5-Associated Factor 1 Antibody / AFF4 Antibody should be determined by the researcher.
Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 / MLLT5-Associated Factor 1 antibody.
After reconstitution, the AFF4 / MLLT5-Associated Factor 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
MLLT5-Associated Factor 1 antibody, AFF4 antibody, AF4/FMR2 Family Member 4 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.