• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> MLLT5-Associated Factor 1 Antibody / AFF4 Antibody

MLLT5-Associated Factor 1 Antibody / AFF4 Antibody [clone 8G12] (RQ6288)

  Catalog No Formulation Size Price (USD)  
Image RQ6288 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
MLLT5-Associated Factor 1 Antibody Human Cancer Cell WB. Western blot analysis of lane 1: human HeLa, lane 2: human HepG2, lane 3: human Caco-2, lane 4: human HEK293, lane 5: human MDA-MB-453, lane 6: human PANC-1, and lane 7: human SW620 cell lysates using MLLT5-Associated Factor 1 Antibody / AFF4 Antibody. A predominant band is detected at approximately 180 kDa, while the predicted molecular weights for AFF4 isoforms are approximately 127, 98, and 39 kDa. The slower migration is consistent with the known electrophoretic behavior of this large nuclear protein and may reflect post-translational modification or anomalous mobility. This MLLT5-Associated Factor 1 Antibody, also called AFF4 Antibody, is suitable for studies of transcription elongation, Super Elongation Complex biology, and nuclear gene regulation.
MLLT5-Associated Factor 1 Antibody 293T Cell FACS. Flow cytometric analysis of fixed and permeabilized human 293T cells using MLLT5-Associated Factor 1 Antibody / AFF4 Antibody at 1 ug/million cells following blocking with goat sera. The red histogram represents unstained cells, the green histogram the isotype control, and the blue histogram AFF4 antibody staining. A distinct rightward shift of the AFF4-stained population demonstrates specific detection of endogenous AFF4 expression. This MLLT5-Associated Factor 1 Antibody, also called AFF4 Antibody, is suitable for studies of transcription elongation, Super Elongation Complex biology, nuclear protein expression, and flow cytometric analysis of AFF4.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG2b
Clone Name 8G12
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9UHB7
Applications Western Blot : 1-2ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This MLLT5-Associated Factor 1 Antibody / AFF4 Antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

MLLT5-Associated Factor 1 Antibody / AFF4 Antibody recognizes AFF4, a nuclear regulatory protein that serves as the central scaffold of the Super Elongation Complex (SEC). By coordinating the assembly of transcription elongation factors, including positive transcription elongation factor b and ELL family proteins, AFF4 promotes productive RNA polymerase II transcription. This activity is essential for the regulated expression of genes involved in development, cellular differentiation, and responses to environmental stimuli.

AFF4 is expressed in a variety of tissues and is localized primarily within the nucleus, where it helps organize large multiprotein complexes responsible for transcriptional elongation. As the structural core of the SEC, AFF4 facilitates interactions among numerous transcriptional regulators, allowing rapid activation of genes that require tightly controlled expression. An MLLT5-Associated Factor 1 Antibody is therefore valuable for studies examining nuclear protein complexes, chromatin-associated regulatory mechanisms, and transcriptional control.

Abnormal regulation of AFF4 has been linked to leukemia driven by KMT2A (formerly MLL) rearrangements, as well as developmental disorders and other diseases involving altered transcriptional programs. Because the Super Elongation Complex also participates in viral transcription and stem cell biology, AFF4 continues to attract interest across multiple areas of biomedical research. Understanding its molecular interactions may provide insight into both normal gene regulation and disease-associated transcriptional dysregulation.

A MLLT5-Associated Factor 1 Antibody is a useful reagent for investigating AFF4 expression, Super Elongation Complex assembly, RNA polymerase II transcription elongation, chromatin-associated protein interactions, and nuclear gene regulation.

Learn more about AFF4 biology, its role in the Super Elongation Complex, and our AFF4 Antibody / AF4/FMR2 Family Member 4 Antibody page for additional validation data and research resources.

Application Notes

Optimal dilution of the MLLT5-Associated Factor 1 Antibody / AFF4 Antibody should be determined by the researcher.

Immunogen

Amino acids RNVLRMKERERRNQEIQQGEDAFPPSSPLFAEPYKVTSKEDKLSSRIQ from the human protein were used as the immunogen for the AFF4 / MLLT5-Associated Factor 1 antibody.

Storage

After reconstitution, the AFF4 / MLLT5-Associated Factor 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

MLLT5-Associated Factor 1 antibody, AFF4 antibody, AF4/FMR2 Family Member 4 antibody

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.