• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ADRA1A Antibody

ADRA1A Antibody (R32076)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32076 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) mouse liver, 5) mouse lung, 6) human 22RV1, and 7) human SMMC lysate with ADRA1A antibody. Expected/observed molecular weight ~52 kDa.
›
Western blot testing of 1) rat heart, 2) rat brain, 3) rat liver, 4) mouse liver, 5) mouse lung, 6) human 22RV1, and 7) human SMMC lysate with ADRA1A antibody. Expected/observed molecular weight ~52 kDa.
IHC staining of FFPE human liver cancer with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
IHC staining of FFPE rat brain with ADRA1A antibody. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 20 min and allow to cool before testing.
Flow cytometry testing of human A431 cells with ADRA1A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ADRA1A antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P35348
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Flow cytometry : 1-3ug/10^6 cells
Limitations This ADRA1A antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ADRA1A, also known as alpha-1A adrenergic receptor, is an alpha-1 adrenergic receptor, and also denotes the human gene encoding it. This gene is mapped to 8p21.2. Alpha-1-adrenergic receptors are G protein-coupled transmembrane receptors that mediate actions in the sympathetic nervous system through the binding of the catecholamines, epinephrine and norepinephrine. It has been found that ADRA1A transcripts in heart, brain, liver, and prostate. ADRA1A is the predominant ADRA1 subtype in liver and heart, and it can mediate the contraction of prostate smooth muscle.

Application Notes

Optimal dilution of the ADRA1A antibody should be determined by the researcher.

Immunogen

Amino acids KAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHKD of human ADRA1A were used as the immunogen for the ADRA1A antibody.

Storage

After reconstitution, the ADRA1A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ADRA1A antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.