• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ADAMTS5 Antibody (C-Terminal Region) [Discontinued]

ADAMTS5 Antibody (C-Terminal Region) [Discontinued] (R32933)

  Catalog No Formulation Size Price (USD)  
Image R32933 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 299
Western blot testing of human placental tissue with ADAMTS5 antibody at 0.5ug/ml. Predicted molecular weight ~102 kDa (unmodified, larger if glycosylated), ~73 kDa (cleaved).
Availability Discontinued
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9UNA0
Localization Cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Limitations This ADAMTS5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ADAMTS5 (A Disintegrin-Like and Metalloproteinase with Thrombospondin Type 1 Motif, 5), is an enzyme that in humans is encoded by the ADAMTS5 gene. ADAMTS5 is a member of the large ADAMTS family of zinc-dependent proteases. The enzyme encoded by this gene contains two C-terminal TS motifs and functions as aggrecanase to cleave aggrecan, a major proteoglycan of cartilage. By somatic cell hybrid analysis, the human ADAMTS5 gene is mapped to chromosome 21. Used mouse models, it is showed that Sdc4 controls a pathway that activates Adamts5 at the chondrocyte cell surface through Erk1/Erk2 activation of Mmp3.

Application Notes

Optimal dilution of the ADAMTS5 antibody should be determined by the researcher.

Immunogen

Amino acids 755-787 (ATHIKVRQFKAKDQTRFTAYLALKKKNGEYLIN) were used as the immunogen for the ADAMTS5 antibody.

Storage

After reconstitution, the ADAMTS5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.