- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
ADAMTS5 (A Disintegrin-Like and Metalloproteinase with Thrombospondin Type 1 Motif, 5), is an enzyme that in humans is encoded by the ADAMTS5 gene. ADAMTS5 is a member of the large ADAMTS family of zinc-dependent proteases. The enzyme encoded by this gene contains two C-terminal TS motifs and functions as aggrecanase to cleave aggrecan, a major proteoglycan of cartilage. By somatic cell hybrid analysis, the human ADAMTS5 gene is mapped to chromosome 21. Used mouse models, it is showed that Sdc4 controls a pathway that activates Adamts5 at the chondrocyte cell surface through Erk1/Erk2 activation of Mmp3.
Optimal dilution of the ADAMTS5 antibody should be determined by the researcher.
Amino acids 755-787 (ATHIKVRQFKAKDQTRFTAYLALKKKNGEYLIN) were used as the immunogen for the ADAMTS5 antibody.
After reconstitution, the ADAMTS5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.