• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ADAM28 Antibody

ADAM28 Antibody (R32798)

  Catalog No Formulation Size Price (USD)  
Image R32798 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HeLa and 2) K562 cell lysate with ADAM28 antibody at 0.5ug/ml. Predicted molecular weight: ~87 kDa (form LM) and ~61 kDa (form LS).
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q9UKQ2
Applications Western Blot : 0.5-1ug/ml
Limitations This ADAM28 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, FACS, Direct ELISA
    Reactivity : Mouse, Rat

Description

Disintegrin and metalloproteinase domain-containing protein 28 is an enzyme that in humans is encoded by the ADAM28 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene is a lymphocyte-expressed ADAM protein. And this gene is present in a gene cluster with other members of the ADAM family on chromosome 8. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the ADAM28 antibody should be determined by the researcher.

Immunogen

Amino acids 207-248 (EYYLVLDNGEFKRYNENQDEIRKRVFEMANYVNMLYKKLNTH) from the human protein were used as the immunogen for the ADAM28 antibody.

Storage

After reconstitution, the ADAM28 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.