• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ACSL5 Antibody

ACSL5 Antibody (R32803)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32803 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Flow cytometry testing of fixed and permeabilized human HL60 cells with ACSL5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ACSL5 antibody.
›
Flow cytometry testing of fixed and permeabilized human HL60 cells with ACSL5 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= ACSL5 antibody.
Western blot testing of 1) rat liver and 2) mouse liver lysate with ACSL5 antibody. Predicted molecular weight ~76 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9ULC5
Applications Western blot : 0.5-1ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This ACSL5 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human

Description

Long-chain-fatty-acid-CoA ligase 5 is an enzyme that in humans is encoded by the ACSL5 gene. The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme is highly expressed in uterus and spleen, and in trace amounts in normal brain, but has markedly increased levels in malignant gliomas. This gene functions in mediating fatty acid-induced glioma cell growth. Three transcript variants encoding two different isoforms have been found for this gene.

Application Notes

Optimal dilution of the ACSL5 antibody should be determined by the researcher.

Immunogen

Amino acids 337-378 (ADDMKTLKPTLFPAVPRLLNRIYDKVQNEAKTPLKKFLLKLA) from the human protein were used as the immunogen for the ACSL5 antibody.

Storage

After reconstitution, the ACSL5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ACSL5 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.