• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Ace Antibody / Angiotensin I converting enzyme

Ace Antibody / Angiotensin I converting enzyme (RQ4007)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4007 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) mouse lung, 2) mouse testis, 3) mouse stomach and 4) rat lung tissue lysate with Ace antibody at 0.5ug/ml. Expected molecular weight 140-170 kDa.
Western blot testing of 1) mouse lung, 2) mouse testis, 3) mouse stomach and 4) rat lung tissue lysate with Ace antibody at 0.5ug/ml. Expected molecular weight 140-170 kDa.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P09470
Applications Western Blot : 0.5-1ug/ml
Limitations This Ace antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Angiotensin I converting enzyme (ACE), also called DCP or CD143 is a zinc-containing dipeptidyl carboxypeptidase widely distributed in mammalian tissues and is thought to play a critical role in blood pressure regulation. This gene is mapped to 17q23.3. This gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies.

Application Notes

Optimal dilution of the Ace antibody should be determined by the researcher.

Immunogen

Amino acids AMMNYFKPLTEWLVTENRRHGETLGWPEYNWAPNTAR from the mouse protein were used as the immunogen for the Ace antibody.

Storage

After reconstitution, the Ace antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Ace antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.