• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ACCN1 Antibody / ASIC2

ACCN1 Antibody / ASIC2 (R32514)

  Catalog No Formulation Size Price (USD)  
Image R32514 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 359
Western blot testing of 1) rat testis and 2) human MCF7 lysate with ACCN1 antibody at 0.5ug/ml. Predicted molecular weight ~58 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q16515
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Limitations This ACCN1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products


Amiloride-sensitive cation channel 1, neuronal, also known as ASIC2, is a protein that in humans is encoded by the ACCN1 gene. This gene encodes a member of the degenerin/epithelial sodium channel (DEG/ENaC) superfamily. The members of this family are amiloride-sensitive sodium channels that contain intracellular N and C termini, 2 hydrophobic transmembrane regions, and a large extracellular loop, which has many cysteine residues with conserved spacing. The member encoded by this gene may play a role in neurotransmission. In addition, a heteromeric association between this member and acid-sensing (proton-gated) ion channel 3 has been observed to co-assemble into proton-gated channels sensitive to gadolinium. Alternative splicing has been observed at this locus and two variants, encoding distinct isoforms, have been identified.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the ACCN1 antibody to be titrated for optimal performance.


Amino acids 112-147 (ELLALLDVNLQIPDPHLADPSVLEALRQKANFKHYK from the human protein were used as the immunogen for the ACCN1 antibody.


After reconstitution, the ACCN1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Bulk Quote Request Form
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image

Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.