• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ABCG8 Antibody

ABCG8 Antibody (R32789)

  Catalog No Formulation Size Price (USD)  
Image R32789 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Immunofluorescent staining of FFPE human HepG2 cells with ABCG8 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human HL60, 2) human K562, 3) human HepG2, 4) rat liver, 5) rat PC-12, 6) mouse liver and 7) mouse HEPA1-6 lysate with ABCG8 antibody at 0.5ug/ml. Predicted molecular weight ~76 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9H221
Applications Western Blot : 0.5-1ug/ml
Immunofluorescence : 5ug/ml
Limitations This ABCG8 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

ATP-binding cassette sub-family G member 8 is a protein that in humans is encoded by the ABCG8 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the White subfamily. The protein encoded by this gene functions to exclude non-cholesterol sterol entry at the intestinal level, promote excretion of cholesterol and sterols into bile, and to facilitate transport of sterols back into the intestinal lumen. It is expressed in a tissue-specific manner in the liver, intestine, and gallbladder. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member ABCG5. Mutations in this gene may contribute to sterol accumulation and atherosclerosis, and have been observed in patients with sitosterolemia.

Application Notes

Optimal dilution of the ABCG8 antibody should be determined by the researcher.

Immunogen

Amino acids 328-371 (DRRSREQELATREKAQSLAALFLEKVRDLDDFLWKAETKDLDED) from the human protein were used as the immunogen for the ABCG8 antibody.

Storage

After reconstitution, the ABCG8 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.