• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ABCC1 Antibody / MRP1

ABCC1 Antibody / MRP1 (R32709)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32709 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa and 2) A549 cell lysate with ABCC1 antibody at 0.5ug/ml. Predicted molecular weight: 152-172 kDa (multiple isoforms), can be observed at ~190 kDa, observed here at ~220 kDa.
Western blot testing of human 1) HeLa and 2) A549 cell lysate with ABCC1 antibody at 0.5ug/ml. Predicted molecular weight: 152-172 kDa (multiple isoforms), can be observed at ~190 kDa, observed here at ~220 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P33527
Applications Western Blot : 0.5-1ug/ml
Limitations This ABCC1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : FACS, IF
    Reactivity : Human
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat, Dog, Pig, Cow
  • Applications : FACS, WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Mouse, Bovine, Primate

Description

Multidrug resistance-associated protein 1 (MRP1) is a protein that in humans is encoded by the ABCC1 gene. The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra-and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This full transporter is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions as a multispecific organic anion transporter, with oxidized glutatione, cysteinyl leukotrienes, and activated aflatoxin B1 as substrates. This protein also transports glucuronides and sulfate conjugates of steroid hormones and bile salts. Alternatively spliced variants of this gene have been described but their full-length nature is unknown.

Application Notes

Optimal dilution of the ABCC1 antibody should be determined by the researcher.

Immunogen

Amino acids 1493-1528 (DYTRVIVLDKGEIQEYGAPSDLLQQRGLFYSMAKDA) from the human protein were used as the immunogen for the ABCC1 antibody.

Storage

After reconstitution, the ABCC1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ABCC1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.