• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ABCA1 Antibody [Discontinued, view alternatives]

ABCA1 Antibody [Discontinued, view alternatives] (R31847)

  Catalog No Formulation Size Price (USD)  
Image R31847 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 299
Western blot testing of 1) rat liver, 2) mouse liver and 3) human SMMC lysate with ABCA1 antibody. Expected/observed molecular weigth: 220~254 kDa.
Availability Discontinued
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O95477
Applications Western blot : 0.1-0.5ug/ml
Limitations This ABCA1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ABCA1 (ATP-binding cassette, sub-family A (ABC1), member 1), also known as ABC1, the cholesterol efflux regulatory protein (CERP) is a protein which in humans is encoded by the ABCA1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes contain 2,261 amino acids. Dot blot analysis of 50 tissues revealed ubiquitous expression of ABCA1 mRNA, with highest expression in placenta, liver, lung, adrenal glands, and all fetal tissues examined, and lowest expression in kidney, pancreas, pituitary, mammary gland, and bone marrow. This protein is a member of the ABCA subfamily. Members of the ABCA subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. With cholesterol as its substrate, this protein functions as a cholesterolefflux pump in the cellular lipid removal pathway. Using human ABCA1 expressed in the membrane fraction of sf9 insect cells, Szakacs et al. found specific, Mg(2+)-dependent ATP binding and low basal ATPase activity. Addition of potential lipid substrates or lipid acceptors did not modify the ATPase activity or nucleotide occlusion by ABCA1. Szakacs et al. speculated that ABCA1 may be a regulatory protein or may require other protein partners for full activation.

Application Notes

Optimal dilution of the ABCA1 antibody should be determined by the researcher.

Immunogen

Amino acids KDLSLHKNQTVVDVAVLTSFLQDEKVKESYV of human ABCA1 were used as the immunogen for the ABCA1 antibody.

Storage

After reconstitution, the ABCA1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.