• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> 5HT3A Receptor Antibody [Discontinued, view alternative antibodies]

5HT3A Receptor Antibody [Discontinued, view alternative antibodies] (R32726)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32726 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Bulk quote request
Western blot testing of 1) rat testis, 2) mouse testis and 3) human placenta lysate with 5HT3A Receptor antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa, observed here at ~72 kDa.
Western blot testing of 1) rat testis, 2) mouse testis and 3) human placenta lysate with 5HT3A Receptor antibody at 0.5ug/ml. Predicted molecular weight ~55 kDa, observed here at ~72 kDa.
Availability Discontinued
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P46098
Applications Western blot : 0.5-1ug/ml
Limitations This 5HT3A Receptor antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

5-hydroxytryptamine receptor 3A is a protein that in humans is encoded by the HTR3A gene. The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit A of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It appears that the heteromeric combination of A and B subunits is necessary to provide the full functional features of this receptor, since either subunit alone results in receptors with very low conductance and response amplitude. Alternatively spliced transcript variants encoding different isoforms have been identified.

Application Notes

Optimal dilution of the 5HT3A Receptor antibody should be determined by the researcher.

Immunogen

Amino acids 72-108 (NVDEKNQVLTTYIWYRQYWTDEFLQWNPEDFDNITKL) from the human protein were used as the immunogen for the 5HT3A Receptor antibody.

Storage

After reconstitution, the 5HT3A Receptor antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all 5HT3A Receptor antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.